Loading...
Statistics
Advertisement

Overseesjob
www.overseesjob.com/

Overseesjob.com

Advertisement
Overseesjob.com is hosted in United Kingdom . Overseesjob.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 3. First javascripts: Jquery-1.8.2.js, Slide.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Overseesjob.com

Technology

Number of occurences: 6
  • CSS
  • Font Awesome
  • Html
  • Javascript
  • jQuery
  • SVG

Advertisement

Javascripts

Number of occurences: 3
  • jquery-1.8.2.js
  • slide.js

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

CDN

Number of occurences: 1
  • BootstrapCDN

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Overseesjob.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL/CN=www.agenteswuperu.com.pe
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL
      • CN: www.agenteswuperu.com.pe
    • hash: b67a4bc9
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 80584515944923710259633404284873979688
    • validFrom: 150601000000Z
    • validTo: 160531235959Z
    • validFrom_time_t: 1433116800
    • validTo_time_t: 1464739199
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 5D:6D:09:06:C4:DF:2B:C9:BE:CA:7C:69:AD:19:E1:1B:E1:39:67:7F
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:www.agenteswuperu.com.pe, DNS:agenteswuperu.com.pe

Meta - Overseesjob.com

Number of occurences: 1
  • Name:
    Content: text/html; charset=utf-8

Server / Hosting

  • IP: 95.215.224.23
  • Latitude: 51.50
  • Longitude: -0.12
  • Country: United Kingdom

Rname

  • ns2.vmaspnet.net
  • ns1.vmaspnet.net
  • mail2.overseesjob.com
  • mail.overseesjob.com

Target

  • hostmaster.overseesjob.com

HTTP Header Response

HTTP/1.1 200 OK Cache-Control: no-cache, no-store Pragma: no-cache Content-Type: text/html; charset=utf-8 Expires: -1 Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Fri, 02 Sep 2016 14:56:31 GMT Content-Length: 143578 X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

DNS

host: overseesjob.com
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 95.215.224.23
host: overseesjob.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.vmaspnet.net
host: overseesjob.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.vmaspnet.net
host: overseesjob.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.vmaspnet.net
  5. rname: hostmaster.overseesjob.com
  6. serial: 2015042802
  7. refresh: 14400
  8. retry: 1200
  9. expire: 1209600
  10. minimum-ttl: 86400
host: overseesjob.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 20
  5. target: mail2.overseesjob.com
host: overseesjob.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: mail.overseesjob.com
host: overseesjob.com
  1. class: IN
  2. ttl: 86400
  3. type: TXT
  4. txt: v=spf1 a:smtp5.ukdns.biz ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.verseesjob.com, www.obverseesjob.com, www.bverseesjob.com, www.ohverseesjob.com, www.hverseesjob.com, www.ogverseesjob.com, www.gverseesjob.com, www.ojverseesjob.com, www.jverseesjob.com, www.omverseesjob.com, www.mverseesjob.com, www.o verseesjob.com, www. verseesjob.com, www.ovverseesjob.com, www.vverseesjob.com, www.oerseesjob.com, www.ovyerseesjob.com, www.oyerseesjob.com, www.ovzerseesjob.com, www.ozerseesjob.com, www.ovherseesjob.com, www.oherseesjob.com, www.ovnerseesjob.com, www.onerseesjob.com, www.ovmerseesjob.com, www.omerseesjob.com, www.ovjerseesjob.com, www.ojerseesjob.com, www.ovkerseesjob.com, www.okerseesjob.com, www.ovierseesjob.com, www.oierseesjob.com, www.ovrseesjob.com, www.ovexrseesjob.com, www.ovxrseesjob.com, www.ovesrseesjob.com, www.ovsrseesjob.com, www.ovewrseesjob.com, www.ovwrseesjob.com, www.overrseesjob.com, www.ovrrseesjob.com, www.ovefrseesjob.com, www.ovfrseesjob.com, www.ovevrseesjob.com, www.ovvrseesjob.com, www.ovecrseesjob.com, www.ovcrseesjob.com, www.oveqrseesjob.com, www.ovqrseesjob.com, www.ovearseesjob.com, www.ovarseesjob.com, www.oveyrseesjob.com, www.ovyrseesjob.com, www.oveseesjob.com, www.overiseesjob.com, www.oveiseesjob.com, www.overoseesjob.com, www.oveoseesjob.com, www.overlseesjob.com, www.ovelseesjob.com, www.overlseesjob.com, www.ovelseesjob.com, www.over.seesjob.com, www.ove.seesjob.com, www.overeesjob.com, www.overseeesjob.com, www.overeeesjob.com, www.oversweesjob.com, www.overweesjob.com, www.oversdeesjob.com, www.overdeesjob.com, www.oversxeesjob.com, www.overxeesjob.com, www.oversfeesjob.com, www.overfeesjob.com, www.oversgeesjob.com, www.overgeesjob.com, www.oversteesjob.com, www.overteesjob.com, www.oversesjob.com, www.oversxesjob.com, www.oversesesjob.com, www.overssesjob.com, www.oversewesjob.com, www.overswesjob.com, www.overseresjob.com, www.oversresjob.com, www.oversefesjob.com, www.oversfesjob.com, www.oversevesjob.com, www.oversvesjob.com, www.oversecesjob.com, www.overscesjob.com, www.overseqesjob.com, www.oversqesjob.com, www.overseaesjob.com, www.oversaesjob.com, www.overseyesjob.com, www.oversyesjob.com, www.oversesjob.com, www.overseexsjob.com, www.overseessjob.com, www.oversessjob.com, www.overseewsjob.com, www.oversewsjob.com, www.overseersjob.com, www.oversersjob.com, www.overseefsjob.com, www.oversefsjob.com, www.overseevsjob.com, www.oversevsjob.com, www.overseecsjob.com, www.oversecsjob.com, www.overseeqsjob.com, www.overseqsjob.com, www.overseeasjob.com, www.overseasjob.com, www.overseeysjob.com, www.overseysjob.com, www.overseejob.com, www.overseesejob.com, www.overseeejob.com, www.overseeswjob.com, www.overseewjob.com, www.overseesdjob.com, www.overseedjob.com, www.overseesxjob.com, www.overseexjob.com, www.overseesfjob.com, www.overseefjob.com, www.overseesgjob.com, www.overseegjob.com, www.overseestjob.com, www.overseetjob.com, www.overseesob.com, www.overseesjzob.com, www.overseeszob.com, www.overseesjhob.com, www.overseeshob.com, www.overseesjnob.com, www.overseesnob.com, www.overseesj.ob.com, www.oversees.ob.com, www.overseesjuob.com, www.overseesuob.com, www.overseesjkob.com, www.overseeskob.com, www.overseesjlob.com, www.overseeslob.com, www.overseesjoob.com, www.overseesoob.com, www.overseesjb.com, www.overseesjobb.com, www.overseesjbb.com, www.overseesjohb.com, www.overseesjhb.com, www.overseesjogb.com, www.overseesjgb.com, www.overseesjojb.com, www.overseesjjb.com, www.overseesjomb.com, www.overseesjmb.com, www.overseesjo b.com, www.overseesj b.com, www.overseesjovb.com, www.overseesjvb.com,

Other websites we recently analyzed

  1. federalcriminalappealslawyers.com
    Scottsdale (United States) - 50.63.202.60
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  2. sanvini.nl
    sanvini.nl
    Netherlands - 62.148.163.233
    Server software: Apache
    Technology: CSS, Html, Html5
    Number of Javascript: 1
    Number of meta tags: 6
  3. Spółdzielnia Mieszkaniowa w Jarosławiu
    Jaroslaw (Poland) - 185.25.120.34
    Server software:
    Technology: BootstrapCDN, CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Lightbox, Php, Pingback, Wordpress
    Number of Javascript: 44
    Number of meta tags: 4
  4. eternal-promi.se.net
    San Jose (United States) - 205.164.14.88
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  5. 508 Espacio Pop Up · Valencia | Diseño, Moda, Eventos, Talleres
    Espacio en el centro de Valencia donde damos cabida a diseñadores, exposiciones, tiendas... Un lugar efímero lleno de creatividad y nuevas experiencias.
    France - 5.135.78.248
    Server software: nginx
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Gravatar, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, WordPress Stats, Wordpress
    Number of Javascript: 37
    Number of meta tags: 5
  6. My Blog – My WordPress Blog
    Austin (United States) - 198.54.116.10
    Server software: Apache
    Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 5
    Number of meta tags: 3
  7. armorygp.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  8. Kaplan Investment / Eda Konutları Antalya
    We provide free flash templates, free templates, free flash header
    Ankara (Turkey) - 217.116.199.188
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 7
    Number of meta tags: 2
  9. spiritofarabia.com
    Scottsdale (United States) - 107.180.50.223
    Server software: Apache/2.4.16
    Technology: Php
  10. 微信公众平台源码,微信机器人源码,微信自动回复源码
    Central District (Hong Kong) - 113.10.175.105
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 6
    Number of meta tags: 2

Check Other Websites